PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.C02957.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 172aa    MW: 19750.7 Da    PI: 9.905
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.C02957.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF85.72.7e-27959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krien++nrqvtfskRr+g+ KKA E+ vLCdaev v+ifss gkly+y+s
  Pahal.C02957.2  9 KRIENSTNRQVTFSKRRAGLVKKAREIGVLCDAEVGVVIFSSGGKLYDYCS 59
                    79***********************************************96 PP

2K-box62.91.2e-2171158188
           K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelq 88 
                     yq++sgk l+++k++sl+ e++++kke++n+q e+Rhl+GedL+sL+  eL  +e++L+++ ++ R+k +++++++ ++ ++ e+e++
  Pahal.C02957.2  71 YQTNSGKILWDEKHKSLSAEIDRVKKENDNMQIELRHLKGEDLNSLQPTELIAIEEALQNGQTNQRDKLMDHWRMHKRNGKMLEDEHK 158
                     89999999*************************************************************9999999999999998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.8E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.043161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-33295IPR002100Transcription factor, MADS-box
CDDcd002653.95E-42280No hitNo description
PRINTSPR004044.3E-29323IPR002100Transcription factor, MADS-box
PfamPF003199.8E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004044.3E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004044.3E-293859IPR002100Transcription factor, MADS-box
PfamPF014866.7E-1482163IPR002487Transcription factor, K-box
PROSITE profilePS5129711.31784170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MGRGKIEIKR IENSTNRQVT FSKRRAGLVK KAREIGVLCD AEVGVVIFSS GGKLYDYCSP  60
RTSLSRILEK YQTNSGKILW DEKHKSLSAE IDRVKKENDN MQIELRHLKG EDLNSLQPTE  120
LIAIEEALQN GQTNQRDKLM DHWRMHKRNG KMLEDEHKLL SFRMVILSPS E*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P4e-20186178Myocyte-specific enhancer factor 2B
1tqe_Q4e-20186178Myocyte-specific enhancer factor 2B
1tqe_R4e-20186178Myocyte-specific enhancer factor 2B
1tqe_S4e-20186178Myocyte-specific enhancer factor 2B
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0542770.0BT054277.1 Zea mays full-length cDNA clone ZM_BFb0210A14 mRNA, complete cds.
GenBankKJ7269300.0KJ726930.1 Zea mays clone pUT3475 MADS transcription factor (MADS29) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004962034.11e-114PREDICTED: MADS-box transcription factor 4-like
SwissprotQ407031e-106MADS4_ORYSJ; MADS-box transcription factor 4
TrEMBLK3Z9J31e-114K3Z9J3_SETIT; Uncharacterized protein
STRINGSi023214m1e-113(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.18e-66MIKC_MADS family protein